PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013629449.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 917aa    MW: 101907 Da    PI: 5.4812
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013629449.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.2e-182975148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd+ l +av+++ g++Wk+Ia+++   Rt+ qc +rwqk+l
   XP_013629449.1 29 KGQWTPEEDQVLCKAVERFQGKNWKKIAECFK-DRTDVQCLHRWQKVL 75
                     799****************************9.************986 PP

2Myb_DNA-binding58.12e-1881127148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEd  ++ +v+++G+  W+tI ++++ gR +kqc++rw+++l
   XP_013629449.1  81 KGPWSKEEDNTIIALVEKYGPTKWSTICQHLP-GRIGKQCRERWHNHL 127
                      79******************************.*************97 PP

3Myb_DNA-binding52.61e-16133175145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++WT+eE++ l++a++ +G++ W+  ++ ++ gR+++++k++w+
   XP_013629449.1 133 KNAWTQEEELTLIRAHQIYGNK-WADLMKFLP-GRSDNSIKNHWN 175
                      689*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.3932475IPR017930Myb domain
SuperFamilySSF466897.18E-192789IPR009057Homeodomain-like
SMARTSM007171.7E-142877IPR001005SANT/Myb domain
PfamPF002494.8E-152975IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-223087IPR009057Homeodomain-like
CDDcd001672.40E-133275No hitNo description
PROSITE profilePS5129431.84176131IPR017930Myb domain
SuperFamilySSF466892.21E-3078174IPR009057Homeodomain-like
SMARTSM007172.6E-1780129IPR001005SANT/Myb domain
PfamPF002492.3E-1781127IPR001005SANT/Myb domain
CDDcd001672.73E-1583127No hitNo description
Gene3DG3DSA:1.10.10.605.7E-2688135IPR009057Homeodomain-like
PROSITE profilePS5129418.256132182IPR017930Myb domain
SMARTSM007171.4E-14132180IPR001005SANT/Myb domain
PfamPF002491.4E-14133176IPR001005SANT/Myb domain
CDDcd001677.29E-11135175No hitNo description
Gene3DG3DSA:1.10.10.601.0E-20136182IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 917 aa     Download sequence    Send to blast
MKAPTNLPQD GTQKGSHGRT CGPARRSTKG QWTPEEDQVL CKAVERFQGK NWKKIAECFK  60
DRTDVQCLHR WQKVLNPDLV KGPWSKEEDN TIIALVEKYG PTKWSTICQH LPGRIGKQCR  120
ERWHNHLNPA INKNAWTQEE ELTLIRAHQI YGNKWADLMK FLPGRSDNSI KNHWNSSVKK  180
KLDSYYASGL LDQFQSSPLI ALQNRSIASS SSWTPSSGDE GKFTPGADAE ESECSQASTV  240
FSCSQTTNDL LDEVKPTDEE FHIPELPSGK EQQISNSPSH AESSKKYQNQ TEVRTTTATE  300
DHLQGDCPQL LTHNMHGEGR NEACQDLQNS VRLSDQPSSP NSDTDIHPQP QTLITDEECC  360
MVLFPNNMKD SDTSFGEQGQ NMVEPQKANR SHANEIGNIP ALSWHPSNSE GRAGQSSVPL  420
LYSDMKDSLL LRNDSNDTIQ GCHLLGATAL ERKTDTNDGF IDADGLVTSH GIDDNDGIPE  480
QQDLSYIPKD SLKLVPLNNF SSPARVKKIH FPIDDKPTEK DKGTLCYEPP RFPSADIPFF  540
SCDLAPSSSD LRQEYSPFGI RQLMISSMSC TTPLRLWDSP CHDKTPDVML KDAGKSFSGA  600
PSILKKRHRD LLAPVLDRRK GKMVKSAEAS SLAKDFSRLD VMLDDGDDNN KGASSSEAKE  660
DPKETLESGV VTSAKIDQET RRSLVYHNDV EMKLSSPDKT GFRPDNEVNT VAKDPLNQHE  720
KSVGTIPTGE ISSELPFTTD SIPLSAFAEI NTNTAESSLD IIENYSIFDG TPFKKLLDTP  780
SPWKSPLLFG SFSQSPNLPP EITFEDIGCF MSPGERSYDA IGLMKHLSEH TATAYADALE  840
VLGNDTPETI IKKRQMNRSI QGKENQLWPH DQLENRSQVE CRALDFSDCV TPGKAKVSSS  900
SPRGYKSPSS YLLKSCR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-64291826159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-64291826159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00466DAPTransfer from AT4G32730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1516460.0AF151646.1 Arabidopsis thaliana PC-MYB1 (PC-MYB1) mRNA, complete cds.
GenBankAF1760050.0AF176005.2 Arabidopsis thaliana putative c-myb-like transcription factor (AtMYB3R-1) mRNA, complete cds.
GenBankAF1897840.0AF189784.1 Arabidopsis thaliana putative c-myb-like transcription factor (MYB3R-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013629448.10.0PREDICTED: myb-related protein 3R-1-like
RefseqXP_013629449.10.0PREDICTED: myb-related protein 3R-1-like
SwissprotQ9S7G70.0MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLA0A0D3BLR90.0A0A0D3BLR9_BRAOL; Uncharacterized protein
STRINGBra034531.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.20.0Homeodomain-like protein